PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010949P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 315aa    MW: 33766.4 Da    PI: 7.0188
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010949P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.2e-3284140360
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     +vrY+eClkNhAas+Gg+ +DGCgEfmps ge+gt +alkCaAC+CHRnFHR+e + e
  MELO3C010949P1  84 GVRYRECLKNHAASVGGNIYDGCGEFMPS-GEDGTLEALKCAACECHRNFHRKEIDGE 140
                     79**************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.8E-3085137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2385138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-3086137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.48787136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.5E-31220292IPR009057Homeodomain-like
SuperFamilySSF466892.5E-20222292IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-28230287IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDMREQEKEV IMPGANSGAG AYGHIFGETS SDRIHNGSHH HIQTDHHDAG ENVGGGGGGG  60
GGGGGGGGNF SSGGRSKARG GVSGVRYREC LKNHAASVGG NIYDGCGEFM PSGEDGTLEA  120
LKCAACECHR NFHRKEIDGE TQLNISPNYR RGLMLNHLQL PPPLPSPSAL HGHHKFSMAL  180
NLHSSPTAPI IAPMNVAFAG GGGNESSSED LNVFHSNAEV MPPSSFSLSK KRFRTKFTQE  240
QKDRMLEFAE KVGWRIQKQD EEEVERFCTE VGVKRQVLKV WMHNNKNTVK KQNENHEPDQ  300
LTGTGAGAGI TNES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-252292881675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444722.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ9FRL52e-67ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A0A0LRH90.0A0A0A0LRH9_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s03660.12e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-62homeobox protein 24